Protein coding transcript 207366

• Transcript: Ll_transcript_248234
• CDS coordinates: 3-2006 (+)
• Peptide sequence: QEITRSIVRIVCREERDSKREKLKKLFVSDMAMPKEKDDKEFHGKKRLKSMRNEQKQVVEVAEEEEDHASRVVEEEEETELPLQQGLFFYPTIPSSFVVCDALELDFPIIYVNKVFEISTGYRADEALGRNCRFLQYRDLRAQRRHPLVDPVVVSEIRRCLQEGIEFQGELLNFRKDGTPLVNRLRLAPIHDDDGTVTHVIGIQLFSEANIDLNHVSYPVFKETCNQDVDKNSKYFPKSGQSLYIQQHQEMCGILQLSDEVLAHNILSRLTPRDIASIGSVCRRIRQLTKNEHVRKMVCQNAWGKEMTGTLERMTKKLGWGRLTRELTTLEAVCWRKMTVRGAVEPSRCNFSACAAGNRLVLFGGEGVDMQPMDDTFVLNLDAKNPVWRRVSVKKSPPGRWGHTLSCLNDSWLVVFGGCGRQGLLNDVFVIDLDAQQPTWTEICGGTPPLPRSWHSACTIEGSKLVVSGGCTDAGVLLNDTYLLDLATENPTWKEIPTSWAPPSRLGHSLSVYGRTKILMFGGLAKSGHLRLRSSEAYTIDLEDEKPQWRQLECSAFTGSASQTAVVPPPRLDHVAVSMPCGRVIIFGGSVAGLHSPSQLFLLDPSEEKPSWRILNVPGQPPKFAWGHSTCVVGGTRVLVLGGHTGEEWILNEVHELCLASRQDSEL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_248234

• Blastp: Adagio protein 3 from Arabidopsis with 80.89% of identity
• Blastx: Adagio protein 3 from Arabidopsis with 82.45% of identity
• Eggnog: Component of an E3 ubiquitin ligase complex that plays a central role in blue light-dependent circadian cycles. Acts as a blue light photoreceptor, due to the presence of FMN, that mediates light-regulated protein degradation of critical clock components by targeting them to the proteasome complex(ENOG410XRGE)
• Kegg: Link to kegg annotations (AT1G68050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422045.1)
• Pfam: PAS domain (PF13426.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;