Protein coding transcript 2074

• Transcript: Ll_transcript_318542
• CDS coordinates: 22-450 (+)
• Peptide sequence: MASLAFRNQSSKNLLFSFRFISSYHSFSPTNAPPSWPPVSLHRSMATFTRTKPHLNVGTIGHVDHGKTTLTAAITKVLADEGKAKAIAFEEIDKAPEEKKRGITIATAHVEYETAKRHYAHVDCPGHADYVKNMITGAAQMDG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_318542

• Blastp: Elongation factor Tu, mitochondrial from Arabidopsis with 71.15% of identity
• Blastx: Elongation factor Tu, mitochondrial from Arabidopsis with 71.15% of identity
• Eggnog: This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis (By similarity)(COG0050)
• Kegg: Link to kegg annotations (AT4G02930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439770.1)
• Pfam: Elongation factor Tu GTP binding domain (PF00009.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;