Transcript | Ll_transcript_250449 |
---|---|
CDS coordinates | 409-897 (+) |
Peptide sequence | MISVNSDECLMTRMQEMSLDYHFTVEQEVGSSTYAFFGFNGTAGVWRIAALNEAGGWKDRTTVEDMDLAVRASLKGWKFLYLSDLKVKNELPSTFKAYRYQQHRWSCGPANLFRKMAMEIIRNKRVTLWKKIYVIYSFFFVRKVVAHITTFVFYCIILPATVV |
ORF Type | 3prime_partial |
Blastp | Glucomannan 4-beta-mannosyltransferase 9 from Arabidopsis with 90% of identity |
---|---|
Blastx | Glucomannan 4-beta-mannosyltransferase 9 from Arabidopsis with 90% of identity |
Eggnog | Glycosyl transferase, family 2(COG1215) |
Kegg | Link to kegg annotations (AT5G03760) |
CantataDB | Link to cantataDB annotations (CNT0002916) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444290.1) |
Pfam | Glycosyltransferase like family 2 (PF13641.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer