Protein coding transcript 207498

• Transcript: Ll_transcript_250450
• CDS coordinates: 570-1277 (+)
• Peptide sequence: MDQLSSSTTILPEAFHGAKDDITMQISLIWSQIKAPLIVPLLRISVVLCLCMSVMMLIERVYMGIVISLVKLFGRKPEKRYKWEPMKDDVELGNSSYPMVLVQVPMYNEREVYQLSIGAACGLSWPSDRIIIQILDDSTDPTIKELVQLECQRWASKGVNIKYEVRDNRNGYKAGALKEGMKRSYVKQCDYVAIFDADFQPEPDYLWRTIPFLVHNHELALIQARWKFGELLNIS*
• ORF Type: complete

Annotations of Ll_transcript_250450

• Blastp: Glucomannan 4-beta-mannosyltransferase 9 from Arabidopsis with 76.55% of identity
• Blastx: Glucomannan 4-beta-mannosyltransferase 9 from Arabidopsis with 76.55% of identity
• Eggnog: Glycosyl transferase, family 2(COG1215)
• Kegg: Link to kegg annotations (AT5G03760)
• CantataDB: Link to cantataDB annotations (CNT0002916)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456632.1)
• Pfam: Glycosyltransferase like family 2 (PF13641.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;