| Transcript | Ll_transcript_318440 |
|---|---|
| CDS coordinates | 1-297 (+) |
| Peptide sequence | YRTAKEEALEKLESLKNENNPELIRSLDAKLSEATSEIEGLQEQLKKLHASEMDSVKLITSELKEATKTLQDIAAEEISLKNLVFSLRTELRQVKKEQD |
| ORF Type | internal |
| Blastp | WEB family protein At1g12150 from Arabidopsis with 56.57% of identity |
|---|---|
| Blastx | WEB family protein At1g12150 from Arabidopsis with 56% of identity |
| Eggnog | Pfam:DUF827(ENOG410ZHIN) |
| Kegg | Link to kegg annotations (AT1G12150) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019434943.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer