Protein coding transcript 20750

• Transcript: Ll_transcript_282148
• CDS coordinates: 215-1339 (+)
• Peptide sequence: MLYQTPHPLHFQFHPFPSSSSSYSISPLQTTSSILSLPLSKVETEMEYCMEGALKTCLRKDMTVKVSPQTFMEDLNVQNGTPCDDFLFVDNLLDFSYVEQQQDEEEPQQQHKEVEGEGEDEGSACVSPRKSNEICNLSLRHEFPSLPTSDLSVPEDVADLEWLSNFVEDSFSDFPTVTTTMTENPNTFFAEKEAKPLNPVFIQPCFKTPVPAKARSKRTRSSIRVWSLGSPCFTESSTSSTSSTSSSSSPTSTLLIYTNLVQNLDQVCSPPKKPKKRVSSDGSVPAPRRCSHCGVQKTPQWRTGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSTELHSNHHRKVLEMRRKKEGTGGVETGFAPPPIVPTF*
• ORF Type: complete

Annotations of Ll_transcript_282148

• Blastp: GATA transcription factor 5 from Arabidopsis with 46.67% of identity
• Blastx: GATA transcription factor 6 from Arabidopsis with 54.15% of identity
• Eggnog: Transcription factor(COG5641)
• Kegg: Link to kegg annotations (AT5G66320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422188.1)
• Pfam: GATA zinc finger (PF00320.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;