Protein coding transcript 20754

• Transcript: Ll_transcript_282233
• CDS coordinates: 1-315 (+)
• Peptide sequence: ETYAPIARLEAIRMLLSFASIMNFKLFQMDVKSAFLNGYIQEEVYVDQPPGFKNFKFPNHVFKLKKALYGLKQAPRAWYERLSTFLLEKGFERGLVDTTLFIRR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_282233

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 38.46% of identity
• Blastx: Copia protein from Sophophora with 36.9% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000573)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434279.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF07727.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;