Protein coding transcript 207597

• Transcript: Ll_transcript_249382
• CDS coordinates: 3-1043 (+)
• Peptide sequence: LTTLVTRFLFSFFSVPFLIGVVTSSLLHTIHGELMEKYEKLQKVGEGTYGKVYKAIEKATGQIVALKKTRLEMDEEGIPPTALREVSLLQLLSQSIYIVRLLSVEHIDKVPKASTPSAQTKHILYLVFEYLDTDLKKFVDSYRKGPNPRPLPPSLIQSFLFQLCKGVAHCHSHGVLHRDLKPQNLLLDQQKGILKIADLGLGRAFTVPLKSYTHEIVTLWYRAPEILLGSTHYSTGVDMWSVGCIFAEMARRQALFPGDSEFKQLLSIFKILGTPTEEQWPGVTSLRDWHVYPRWEPQNLARAVPSLGPHGVDLLTKMLKYNPAERISAKVALDHPYFDTLDKCQF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_249382

• Blastp: Cyclin-dependent kinase B1-1 from Arabidopsis with 83.33% of identity
• Blastx: Cyclin-dependent kinase B1-1 from Arabidopsis with 83.33% of identity
• Eggnog: Cyclin-Dependent Kinase(ENOG410XPP3)
• Kegg: Link to kegg annotations (AT3G54180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426991.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;