Protein coding transcript 207606

• Transcript: Ll_transcript_250339
• CDS coordinates: 3-386 (+)
• Peptide sequence: YLLHGIVDEKTDVFAFGVLLLELVSGRRALDYSQQSLVLWAKPLLKKNDIKELIDPSIADEFDSRQMNLMLLAASLCIHQSSIRRPSMRQVVQLLNGNLSCFKGMEKSRLPFFRKVFQQELLHCEIV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_250339

• Blastp: Receptor-like cytosolic serine/threonine-protein kinase RBK2 from Arabidopsis with 54.92% of identity
• Blastx: Receptor-like cytosolic serine/threonine-protein kinase RBK2 from Arabidopsis with 54.92% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT3G05140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426766.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;