Transcript | Ll_transcript_250131 |
---|---|
CDS coordinates | 247-738 (+) |
Peptide sequence | MVCKLKKFIYGLKQASRQWNHKFHQVITSHGFEANKVDDCVYHSGSKFIFLVLYVDDILLASSDMGLLYETKRFLTKNFEMKDLGEVSFVLGIQILRDRSQGILRFSQEIYIDKVLDRFGMKESKPGDSPIDMGNKFCLEQCPKVTLKDTRCKIYFLCICTGR* |
ORF Type | complete |
Blastp | Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 45.89% of identity |
---|---|
Blastx | Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 45.89% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020997393.1) |
Pfam | Reverse transcriptase (RNA-dependent DNA polymerase) (PF07727.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer