Protein coding transcript 20766

• Transcript: Ll_transcript_282985
• CDS coordinates: 63-410 (+)
• Peptide sequence: MKVIAAYLLAVLGGNETPSAADIKNILGSVGAEAEAEKIELLLNEVKGKSLVELIASGREKLASVPSGGGAVAVAAAPAGGAAAGGSAPAAEAKVEKKVEEKEESDDDMGFSLFD*
• ORF Type: complete

Annotations of Ll_transcript_282985

• Blastp: 60S acidic ribosomal protein P2B from Zea with 68.7% of identity
• Blastx: 60S acidic ribosomal protein P2-1 from Arabidopsis with 68.7% of identity
• Eggnog: Ribosomal protein(COG2058)
• Kegg: Link to kegg annotations (542340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436328.1)
• Pfam: 60s Acidic ribosomal protein (PF00428.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;