Protein coding transcript 207674

• Transcript: Ll_transcript_248073
• CDS coordinates: 245-625 (+)
• Peptide sequence: MLDSVLLALFLPCLGMSLIFIIYMCLLWYATTYRSDNPRLPVKPVSEKGLSASELEKLPRITGRELVMGTECAVCLDEIENEQPARLVPACNHGFHVECADTWLSNHPFCPVCRAKLDPQLFNNPC*
• ORF Type: complete

Annotations of Ll_transcript_248073

• Blastp: E3 ubiquitin-protein ligase ATL23 from Arabidopsis with 59.52% of identity
• Blastx: E3 ubiquitin-protein ligase ATL23 from Arabidopsis with 56.72% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT5G42200)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438075.1)
• Pfam: Zinc finger, C3HC4 type (RING finger) (PF13920.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;