Protein coding transcript 2077

• Transcript: Ll_transcript_318517
• CDS coordinates: 136-993 (+)
• Peptide sequence: MKLVERIDLEEAASAGMKGMRHLLQLMSSSDDQTNVKPNHIDCTEITEFTVSKFKQVINLLNAYLPKPHTSPPSGHARFRRTPSIPSPSPSPSASEPEEFNHINHQPQTESMTRGLSPLHSTSPVIVDSNPNPCTEMVSVPQISSPNDSSPNISMAGDRSVPDSNVDLSIIVAAQPISAAQPLPVPSSRGKRGPRDTHSDDCPCSKTRVQPGVVRTLRVRIGDIADRYSWRKYGQKYIKGAPYPRDYYRCSSVKGCPARKRVERDEEDFNILVINYHGDHCHPNA*
• ORF Type: complete

Annotations of Ll_transcript_318517

• Blastp: Probable WRKY transcription factor 17 from Arabidopsis with 35.65% of identity
• Blastx: Probable WRKY transcription factor 17 from Arabidopsis with 34.59% of identity
• Eggnog: WRKY transcription factor(ENOG410YD1E)
• Kegg: Link to kegg annotations (AT2G24570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414204.1)
• Pfam: WRKY DNA -binding domain (PF03106.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;