Protein coding transcript 20770

• Transcript: Ll_transcript_282983
• CDS coordinates: 73-420 (+)
• Peptide sequence: MKVIAAYLLAVLGGNKTPSQKDIKNILASVGAEADDDRIELLLSEVKGKEIEDIIASGREKLASVPSGGGAVAVAAAPGGAAGGAAAPAAAEAKKEEKVVEKEESDDDMGFSLFD*
• ORF Type: complete

Annotations of Ll_transcript_282983

• Blastp: 60S acidic ribosomal protein P2B from Zea with 65.22% of identity
• Blastx: 60S acidic ribosomal protein P2 from Parthenium with 72.58% of identity
• Eggnog: Ribosomal protein(COG2058)
• Kegg: Link to kegg annotations (542340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451250.1)
• Pfam: 60s Acidic ribosomal protein (PF00428.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;