Protein coding transcript 207746

• Transcript: Ll_transcript_249057
• CDS coordinates: 1886-2344 (+)
• Peptide sequence: MVSFGVEDFEKRFGGLKPSQFVDMIALTGDRADNIPGVHGIGDVHAVQLISKFGTLERLLDSVDQVAEDRIKKALIANAEQALLSKELALLRCDLPFYMVPFTTKDITFNKPEDDGSKFNSLLNAIGDYAEGFSADPTIRRAFHLWKKLDSR*
• ORF Type: complete

Annotations of Ll_transcript_249057

• Blastp: DNA polymerase I from Geobacillus thermoleovorans group with 42.48% of identity
• Blastx: DNA polymerase I from Escherichia with 33.73% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424416.1)
• Pfam: 5'-3' exonuclease, C-terminal SAM fold (PF01367.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;