Protein coding transcript 207779

• Transcript: Ll_transcript_249422
• CDS coordinates: 449-883 (+)
• Peptide sequence: MAIKTIESLKGCGSEEEIMEIICAVGSDLGDVKDDVNSLEVIPMKGAMTNEVFEINWEAKNGGGVRKALLRLYGDGVEILFNREEEIRIFECISKHGQGPRLLARFTSGRVEEFLHARVCHFLLLLFCFLFIRTIGFLTNRLLG*
• ORF Type: complete

Annotations of Ll_transcript_249422

• Blastp: Probable choline kinase 1 from Arabidopsis with 56.2% of identity
• Blastx: Probable choline kinase 1 from Arabidopsis with 56.2% of identity
• Eggnog: Ethanolamine kinase(COG0510)
• Kegg: Link to kegg annotations (AT1G71697)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427266.1)
• Pfam: Choline/ethanolamine kinase (PF01633.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;