Protein coding transcript 207838

• Transcript: Ll_transcript_249718
• CDS coordinates: 124-1245 (-)
• Peptide sequence: MFSTENICRGDSADISSTTDSGHMDVNHQKVNTKSNTGRIPLSARKACQNYVGNPHYLKPDDWHVEVAVPGTHSSVEFRNEESVSNSVTKPLETMSVDVTSMQDVGCEYVPMDEKQESSSVSNLATDNFETKFLTASHDCFIDSGLQKPFNIFTEEADQGGRNSFSENSKFVRQSQNVASPRFSICTPRPSVDTDDKQTGYLPVKSSEAFENKTYSRIQPMNSSGVSVDMWKSCKVTTNANFFKEQDDLNSSGKNTRSMGSAQMRKSDGTVSSAMSANGRNGCSCESNTNYWNCVKRLVCEGDLNTAYMEALRSDDERILVELLNKTGPVVESLSVKTVNVLFNTLASYLVEGRFFDTIIPWLQQAISLALID*
• ORF Type: complete

Annotations of Ll_transcript_249718

• Blastp: TORTIFOLIA1-like protein 2 from Arabidopsis with 33.33% of identity
• Blastx: TORTIFOLIA1-like protein 2 from Arabidopsis with 33.33% of identity
• Eggnog: Microtubule-associated protein(ENOG410ZR3M)
• Kegg: Link to kegg annotations (AT2G07170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457225.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;