Protein coding transcript 207860

• Transcript: Ll_transcript_71516
• CDS coordinates: 197-1144 (+)
• Peptide sequence: MASPPSSSISKPLKQIPGTYGLPFLGPIIDRHNYFYHQGQDKFFATRIKQYNSTVIRTNMPPGPFISLNSKVIALLDGASFPILFDNSKVEKRNVLDGTFMPSTNFTGGYRVCAYLDTTEPNHTILKQFFINVLVSKKETFVPLFRNTLSESFRELEDQLYGKNGEAKFNDVFGAGAFNFMFRLLCENKDPLETKLGSEGPGLFDKWLLFQLAPLATLGLPKIFNYIEDFVIRTVPFPFWFAKSGYKKLYAVISEEAKTLLDEAEKVVIEIRMIIYIKCHFHIKKLTFFTSSFKKNYKLNIYRVLVSDIKHIVID*
• ORF Type: complete

Annotations of Ll_transcript_71516

• Blastp: Allene oxide synthase 3 from Lycopersicon with 47.04% of identity
• Blastx: Allene oxide synthase 3 from Lycopersicon with 47.04% of identity
• Eggnog: Cytochrome p-450(ENOG410Y1KX)
• Kegg: Link to kegg annotations (101247264)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462421.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;