Protein coding transcript 207881

• Transcript: Ll_transcript_71481
• CDS coordinates: 1-741 (+)
• Peptide sequence: AHTIKEICSVHNETATGVTNNLATVRKILDAYQHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVLASAKALEASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVISRHNRLGTATRLAVEAWGLKNCTQKEEWYSDTVTAVVVPAYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGS
• ORF Type: internal

Annotations of Ll_transcript_71481

• Blastp: Serine--glyoxylate aminotransferase from Arabidopsis with 86.59% of identity
• Blastx: Serine--glyoxylate aminotransferase from Arabidopsis with 86.59% of identity
• Eggnog: aminotransferase(COG0075)
• Kegg: Link to kegg annotations (AT2G13360)
• CantataDB: Link to cantataDB annotations (CNT0002976)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458488.1)
• Pfam: Aminotransferase class-V (PF00266.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;