Protein coding transcript 207884

• Transcript: Ll_transcript_71495
• CDS coordinates: 522-1028 (+)
• Peptide sequence: MDYVYGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAIPAMTKTLLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRTISFLIGQFSLLWIDQQQRLKFNVDVVESEWGRGADLDILESKLASDTAHTIKAICIVHNETATGVTNNLATVRKILGEHVI*
• ORF Type: complete

Annotations of Ll_transcript_71495

• Blastp: Serine--glyoxylate aminotransferase from Arabidopsis with 82.53% of identity
• Blastx: Serine--glyoxylate aminotransferase from Arabidopsis with 82.53% of identity
• Eggnog: aminotransferase(COG0075)
• Kegg: Link to kegg annotations (AT2G13360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455950.1)
• Pfam: Aminotransferase class-V (PF00266.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;