Protein coding transcript 207937

• Transcript: Ll_transcript_71231
• CDS coordinates: 152-649 (+)
• Peptide sequence: MNQSLLLSSFFFLIFSLSVSSFSYTSLSDEVFESQVHKGRNLLQTRKGCSVNFEFLNYTIITSRCKGPAYLPKDCCAAFKDFACPYADVLNDLQNDCASTMFSYINLYGQYPPGLFANECREGKEGLACPALPPSESANDTGNQITHCPSLLLLLVTACLLIMLF*
• ORF Type: complete

Annotations of Ll_transcript_71231

• Blastp: GPI-anchored protein LLG1 from Arabidopsis with 67.86% of identity
• Blastx: GPI-anchored protein LLG1 from Arabidopsis with 75.44% of identity
• Eggnog: (GPI)-anchored protein(ENOG410YIWK)
• Kegg: Link to kegg annotations (AT5G56170)
• CantataDB: Link to cantataDB annotations (CNT0002168)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431969.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;