Protein coding transcript 207938

• Transcript: Ll_transcript_71234
• CDS coordinates: 1-471 (+)
• Peptide sequence: EGLENGPAALVGLFSGRNVETILDSQEHKGRNLLQISKGCPVNFEFLNYTIITSRCKGPAYLPKDCCAAFKDFACPYADVLNDLQNDCASTMFSYINLYGQYPPGLFANECREGKEGLACPALPPSESANDTGNQITHCPSLLLLLVTACLLIMLF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_71234

• Blastp: GPI-anchored protein LLG1 from Arabidopsis with 68.99% of identity
• Blastx: GPI-anchored protein LLG1 from Arabidopsis with 77.67% of identity
• Eggnog: (GPI)-anchored protein(ENOG410YIWK)
• Kegg: Link to kegg annotations (AT5G56170)
• CantataDB: Link to cantataDB annotations (CNT0002168)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431969.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;