Protein coding transcript 207969

• Transcript: Ll_transcript_72476
• CDS coordinates: 63-467 (+)
• Peptide sequence: MVKGLEALSHMTNGTGNGDQSHFDPGAPPPFKIAEIRAVIPKHCWVKNPWKSLSYVLRDLLIVTALIAAAIWFNSWFFWPLYWVAQGTMFWAIFVLGHDCGHGSFSDSTKLNNLVGHILHSSILVPFHGWRISHR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_72476

• Blastp: Omega-3 fatty acid desaturase, endoplasmic reticulum from Vigna with 76.92% of identity
• Blastx: Omega-3 fatty acid desaturase, endoplasmic reticulum from Vigna with 76.92% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420031.1)
• Pfam: Domain of unknown function (DUF3474) (PF11960.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;