Transcript | Ll_transcript_72478 |
---|---|
CDS coordinates | 623-1288 (+) |
Peptide sequence | MFRSLDNMTRNLRFTAPFPLLAYPVYLFSRSPGKTGSHFHPDSDLFGPNERNDIITSTLCWSAMVAILVGLSFVMGAGQVFMLYGVPYWLFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTIDRDYGWINNIHHDIGTHVVHHLFPQIPHYHLTEATEAAKPVFGKYYREPKKSGPIPFHLVGDFVRSLKKDHYVSDTGDIVFYESDPQLSGSSK* |
ORF Type | complete |
Blastp | Omega-3 fatty acid desaturase, chloroplastic from Soja with 80.18% of identity |
---|---|
Blastx | Omega-3 fatty acid desaturase, chloroplastic from Sesamum with 79.76% of identity |
Eggnog | linoleoyl-CoA desaturase activity(COG3239) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450336.1) |
Pfam | Fatty acid desaturase (PF00487.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer