Protein coding transcript 207972

• Transcript: Ll_transcript_72480
• CDS coordinates: 63-1196 (+)
• Peptide sequence: MVKGLEALSHMTNGTGNGDQSHFDPGAPPPFKIAEIRAVIPKHCWVKNPWKSLSYVLRDLLIVTALIAAAIWFNSWFFWPLYWVAQGTMFWAIFVLGHDCGHGSFSNDHKLNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWQPLTEKMFRSLDNMTRNLRFTAPFPLLAYPVYLFSRSPGKTGSHFHPDSDLFGPNERNDIITSTLCWSAMVAILVGLSFVMGAGQVFMLYGVPYWLFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTIDRDYGWINNIHHDIGTHVVHHLFPQIPHYHLTEATEAAKPVFGKYYREPKKSGPIPFHLVGDFVRSLKKDHYVSDTGDIVFYESDPQLSGSSK*
• ORF Type: complete

Annotations of Ll_transcript_72480

• Blastp: Omega-3 fatty acid desaturase, chloroplastic from Sesamum with 77.56% of identity
• Blastx: Omega-3 fatty acid desaturase, chloroplastic from Sesamum with 77.56% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (105167042)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450336.1)
• Pfam: Domain of unknown function (DUF3474) (PF11960.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;