Protein coding transcript 207973

• Transcript: Ll_transcript_72481
• CDS coordinates: 1359-1835 (+)
• Peptide sequence: MVAILVGLSFVMGAGQVFMLYGVPYWLFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTIDRDYGWINNIHHDIGTHVVHHLFPQIPHYHLTEATEAAKPVFGKYYREPKKSGPIPFHLVGDFVRSLKKDHYVSDTGDIVFYESDPQLSGSSK*
• ORF Type: complete

Annotations of Ll_transcript_72481

• Blastp: Omega-3 fatty acid desaturase, chloroplastic from Sesamum with 81.01% of identity
• Blastx: Omega-3 fatty acid desaturase, chloroplastic from Sesamum with 80.41% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (105167042)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450336.1)
• Pfam: Fatty acid desaturase (PF00487.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;