Protein coding transcript 207974

• Transcript: Ll_transcript_72485
• CDS coordinates: 400-1065 (+)
• Peptide sequence: MFRSLDNMTRNLRFTAPFPLLAYPVYLFSRSPGKTGSHFHPDSDLFGPNERNDIITSTLCWSAMVAILVGLSFVMGAGQVFMLYGVPYWLFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTIDRDYGWINNIHHDIGTHVVHHLFPQIPHYHLTEATEAAKPVFGKYYREPKKSGPIPFHLVGDFVRSLKKDHYVSDTGDIVFYESDPQLSGSSK*
• ORF Type: complete

Annotations of Ll_transcript_72485

• Blastp: Omega-3 fatty acid desaturase, chloroplastic from Soja with 80.18% of identity
• Blastx: Omega-3 fatty acid desaturase, chloroplastic from Sesamum with 80.81% of identity
• Eggnog: linoleoyl-CoA desaturase activity(COG3239)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450336.1)
• Pfam: Fatty acid desaturase (PF00487.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;