Protein coding transcript 207975

• Transcript: Ll_transcript_72487
• CDS coordinates: 3-311 (+)
• Peptide sequence: SHPCLSDNMNIYHVLFSKNSFDFPIVPSQLLVPLSTIIFILSLTVFFGFSLGDPAGARLKPGSGYGYGFGIRVDSPLGPLRLEYAFNDKKYQRFHFGVGHRN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_72487

• Blastp: Outer envelope protein 80, chloroplastic from Oryza sativa with 88.24% of identity
• Blastx: Outer envelope protein 80, chloroplastic from Oryza sativa with 88.24% of identity
• Eggnog: Gram-negative-bacterium-type cell outer membrane assembly(COG4775)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458659.1)
• Pfam: Surface antigen (PF01103.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;