Protein coding transcript 20807

• Transcript: Ll_transcript_282509
• CDS coordinates: 116-601 (+)
• Peptide sequence: MIHFVLLISRQGKVRLAKWYSPYSQKERSKVIRELSGVIISRAPKLCNFVEWRGLKVVYKRYASLYFCICNDQEDNELETLSIIHHYVETLDRYFGSVCELDLIFNFHKAYFLLDEILLAGEMQETSKRTILRLISAQEDLVEAAKEEASSLSNIIAQATK*
• ORF Type: complete

Annotations of Ll_transcript_282509

• Blastp: AP-1 complex subunit sigma-2 from Arabidopsis with 83.75% of identity
• Blastx: AP-1 complex subunit sigma-2 from Arabidopsis with 83.75% of identity
• Eggnog: Adaptor-related protein complex(COG5030)
• Kegg: Link to kegg annotations (AT4G35410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434339.1)
• Pfam: Clathrin adaptor complex small chain (PF01217.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;