Transcript | Ll_transcript_72252 |
---|---|
CDS coordinates | 1043-1912 (+) |
Peptide sequence | MYADFIGSAGSIFDLTTQLYPDYFLPLASLGNLTKAIARGLKDPSFRVIQNHFALSGNVGDVAAKEEVWEVVAQLAGLGLGILILDTPGLVKSYPVLLSTWMSMRLLHIWLRYESLSVLQFNTINLKRARILVKSHVLHSTVPGCKDCNREENILTWPQFMKPEIIFGLPLEKMNIERSHFMVKAFLKLYAHEKYILMVNQQQQDLRFHVSFKVGATSVSVLRSVWQSFWLSENWNREGNVCDQLGNSLMELENKFEDFIQKLKVAEWDTQKLNLKVPKEILIDDINPL* |
ORF Type | complete |
Blastp | Protein root UVB sensitive 5 from Arabidopsis with 64.36% of identity |
---|---|
Blastx | Protein root UVB sensitive 5 from Arabidopsis with 65.78% of identity |
Eggnog | Chromosome 16 open reading frame 58(ENOG410XU74) |
Kegg | Link to kegg annotations (AT5G01510) |
CantataDB | Link to cantataDB annotations (CNT0001676) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003530281.2) |
Pfam | Vitamin B6 photo-protection and homoeostasis (PF04884.13) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer