| Transcript | Ll_transcript_72229 |
|---|---|
| CDS coordinates | 196-1065 (+) |
| Peptide sequence | MSQILQLSFSSTSTGLSSSVKMKGTAKRPFFFQILCSSSKHSSFKDEDDDNVNKGDRGLSRVILVERYSNGTAKRYVVDDDSQLQTFLFEEDKSTTNMLQDSQRLSWLPEIIKDFILPAGFPGSVSDDYLNYMLLQFPTNVTGWICHTLVTSSLLKAVGVGSFSGSTAAASAAAIRWVSKDGIGAVGRLFIGGRFGNLFDDDPKQWRMYADFIGSAGSIFDLTTQLYPDYFLPLASLGNLTKAIARGLKDPSFRVIQNHFALSGNVGDVAAKVYSHVKTIILEKNYCHF* |
| ORF Type | complete |
| Blastp | Protein root UVB sensitive 5 from Arabidopsis with 71.23% of identity |
|---|---|
| Blastx | Protein root UVB sensitive 5 from Arabidopsis with 70.78% of identity |
| Eggnog | Chromosome 16 open reading frame 58(ENOG410XU74) |
| Kegg | Link to kegg annotations (AT5G01510) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019462270.1) |
| Pfam | Vitamin B6 photo-protection and homoeostasis (PF04884.13) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer