Protein coding transcript 208126

• Transcript: Ll_transcript_70964
• CDS coordinates: 1-309 (+)
• Peptide sequence: IASGTSENTKVVIDHGAVPIFVKLLSSPSEDVREQAVWALGNVAGDSPRCRDLVLSQGALIPLLAQLNEHAKLSMLRNATWTLSNFCRGKPQPPFEEVRPALP
• ORF Type: internal

Annotations of Ll_transcript_70964

• Blastp: Importin subunit alpha-2 from Arabidopsis with 91.26% of identity
• Blastx: Importin subunit alpha-2 from Arabidopsis with 91.26% of identity
• Eggnog: importin subunit alpha(COG5064)
• Kegg: Link to kegg annotations (AT4G16143)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020227577.1)
• Pfam: Armadillo/beta-catenin-like repeat (PF00514.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;