Protein coding transcript 208130

• Transcript: Ll_transcript_70983
• CDS coordinates: 3-326 (+)
• Peptide sequence: CRGKPQPPFEQVRPALPTLERLVFSNDEEVLTDACWALSYLSDGTDDKIQAVIETGVCTRLVQLLLHPSPSVLIPALRTVGNIVTGDDMQTQVVICKLLLLSHGTIK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_70983

• Blastp: Importin subunit alpha-1a from Oryza sativa with 76.99% of identity
• Blastx: Importin subunit alpha-1a from Oryza sativa with 76.99% of identity
• Eggnog: importin subunit alpha(COG5064)
• Kegg: Link to kegg annotations (4327117)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020227577.1)
• Pfam: Armadillo/beta-catenin-like repeat (PF00514.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;