Protein coding transcript 20815

• Transcript: Ll_transcript_282530
• CDS coordinates: 220-912 (+)
• Peptide sequence: MDPNPRTFPILSYVMSRLPSFGSTTVISHIQSDIEQPPSSDPSSSSSASIVGQMPQLADPKLLAAMTSTISDVSQARSVLKLIGERPTHEDVDTAKAQLADIEAHLSRQMQEIVGLPRPPEIDPDKWQVHVAQKEKECKESFEKEKRVYKSLIQLDEMHAAYEKLLNDAEKRLEKLYKNAGEDDDEKGGGGGGGGSGSEEEVNEQVHEILQEADVKGVERVDLSGQRLKFL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_282530

• Blastp: Plant intracellular Ras-group-related LRR protein 9 from Arabidopsis with 42.98% of identity
• Blastx: Plant intracellular Ras-group-related LRR protein 9 from Arabidopsis with 41.49% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT3G11330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463827.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;