Transcript | Ll_transcript_72554 |
---|---|
CDS coordinates | 437-787 (+) |
Peptide sequence | MSLETNLLAKAKRHAAFRLCDVSNYTSEILEIQADAPSLHVLFVPGNPGVIFFYKDFVEYLYELLGGTASVTAIGHVSQTKKNWEHGRLFSLHEQIDHKIDFIREELKNTEIPIVLI |
ORF Type | 3prime_partial |
Blastp | Uncharacterized protein YPR147C from Saccharomyces with 29.13% of identity |
---|---|
Blastx | Uncharacterized protein YPR147C from Saccharomyces with 29.13% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YPR147C) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456266.1) |
Pfam | Lipid-droplet associated hydrolase (PF10230.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer