Protein coding transcript 208177

• Transcript: Ll_transcript_72566
• CDS coordinates: 240-590 (+)
• Peptide sequence: MSLETNLLAKAKRHAAFRLCDVSNYTSEILEIQADAPSLHVLFVPGNPGVIFFYKDFVEYLYELLGGTASVTAIGHVSQTKKNWEHGRLFSLHEQIDHKIDFIREELKNTEIPIVLI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_72566

• Blastp: Uncharacterized protein YPR147C from Saccharomyces with 29.13% of identity
• Blastx: Uncharacterized protein YPR147C from Saccharomyces with 29.13% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YPR147C)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456265.1)
• Pfam: Lipid-droplet associated hydrolase (PF10230.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;