Protein coding transcript 208186

• Transcript: Ll_transcript_72548
• CDS coordinates: 1-774 (+)
• Peptide sequence: IYATSELKEMVVKLVSCSAPTLSHSLLFLSSTSRTRFSVKCFSKDMGVETNLLANAKKRADFRLCNVSSYTSEILEIQADTPSLHVLFVPGNPGVILFYKDFVEYLFELLGGIASVTAIGNVSHTKKNWEHGRLFSLQEQIDHKVDFIREELKNSEIPIVLIGHSIGSYIAIEMFKRSPEKVKYCIGLYPFLTLNPHSEKQIVIGKIAESRIISAALSCLIASLGLLPVWALRFIVRNSVGKSWSANAVEAVCSHLSQ
• ORF Type: internal

Annotations of Ll_transcript_72548

• Blastp: Lipid droplet-associated hydrolase from Dictyostelium with 33.33% of identity
• Blastx: Lipid droplet-associated hydrolase from Dictyostelium with 33.33% of identity
• Eggnog: chromosome 2 open reading frame 43(ENOG410ZTV7)
• Kegg: Link to kegg annotations (DDB_G0286581)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456266.1)
• Pfam: Lipid-droplet associated hydrolase (PF10230.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;