Transcript | Ll_transcript_72102 |
---|---|
CDS coordinates | 502-1083 (+) |
Peptide sequence | MDLATLNSTLDKLIIKVVPMENLNGRKLVEAGDLCERRNGRGVDLNRNWSVDWGKKEKDYDPYEENPGFAPFSEPETQIMQKLAMSFDPHIWVNVHSGMEALFMPYDHKNTTPDELPLQRMKSLLEEVNLLHCQKHCMIGSGGGSVGFSCFPVGYVCFILLLMSISVNIMERGGNDHCSFLGAFFLICRHCNT* |
ORF Type | complete |
Blastp | Metallocarboxypeptidase A-like protein TRV_02598 from Trichophyton with 28.26% of identity |
---|---|
Blastx | Metallocarboxypeptidase A-like protein TRV_02598 from Trichophyton with 27.75% of identity |
Eggnog | metallocarboxypeptidase activity(COG2866) |
Kegg | Link to kegg annotations (TRV_02598) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020234667.1) |
Pfam | Zinc carboxypeptidase (PF00246.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer