Protein coding transcript 208311

• Transcript: Ll_transcript_71851
• CDS coordinates: 3-731 (+)
• Peptide sequence: PAVSEYTQRKIFVSNVSADIDPQKLLEFFRQFGEVEDGPLGLDKQTGKPKGFALFVYKSVDSAKKALEDPQKQFEGHVLYCQKAVDGPKGKQGYHQQPHHQHNQQQHHSHHHHQPHHYQRKERNKYTSGGPAHGGGHLMAPSGPPVGYNPGVQGAQGLNPVLGQAISALLTTQGAGLGLGNFLGGLGGAPMNQSVPPAGYGNQPAMNYGNQQGMQQGYPNPQMGQGSGVRPHPGAGAPYMGH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_71851

• Blastp: UBP1-associated protein 2B from Arabidopsis with 53.97% of identity
• Blastx: UBP1-associated protein 2B from Arabidopsis with 53.99% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: Link to kegg annotations (AT2G41060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460492.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;