Transcript | Ll_transcript_71853 |
---|---|
CDS coordinates | 3-545 (+) |
Peptide sequence | KKALEDPHKQFEGHVLYCQKAVDGPKGKQGYHQQPHHQHHQHQHHSHHHHQPHFQRKDRNKYSSSGGPAHGGGHLMAPSGPSVGGYNPGVPAAQGLNPVLGQAISALLTTQGAGLGLGNLLGGLGGAHVNHSVPPGGYGNQPTMNYGNQPGMLQGYQNPQMGQSSGVRPHPGAGAPYMGH* |
ORF Type | 5prime_partial |
Blastp | UBP1-associated protein 2A from Arabidopsis with 46.97% of identity |
---|---|
Blastx | UBP1-associated protein 2A from Arabidopsis with 43.43% of identity |
Eggnog | Rna-binding protein(COG0724) |
Kegg | Link to kegg annotations (AT3G56860) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455896.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer