Protein coding transcript 208315

• Transcript: Ll_transcript_71855
• CDS coordinates: 3-545 (+)
• Peptide sequence: KKALEDPHKQFEGHVLYCQKAVDGPKGKQGYHQQPHHQHHQHQHHSHHHHQPHFQRKDRNKYSSSGGPAHGGGHLMAPSGPSVGGYNPGVPAAQGLNPVLGQAISALLTTQGAGLGLGNLLGGLGGAHVNHSVPPGGYGNQPTMNYGNQPGMLQGYQNPQMGQSSGVRPHPGAGAPYMGH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_71855

• Blastp: UBP1-associated protein 2A from Arabidopsis with 46.97% of identity
• Blastx: UBP1-associated protein 2A from Arabidopsis with 43.43% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: Link to kegg annotations (AT3G56860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455896.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;