Protein coding transcript 208375

• Transcript: Ll_transcript_73354
• CDS coordinates: 674-1663 (+)
• Peptide sequence: MATYFHGGSSSEIQSPAEGLQTLYLMNPNYVPYSDAPQHPTPNMFLINPNTAPSTTPPSHALNLSNFIHAPPPPNNNDNHHHHHMTGATIPLSNTTGSTNTDEISSYHDFAAAAPRVHYNMWGFDQTPWSAAAVTIAATPTNNSGYASTTVSAAAADISHQVGFHRPNNHQQGLSLSLSSQQPDYRMLSGEISAATHGSGISGMNNNNNNNNGILGSKYLKATHELLDEVVNVGKGIFKGESINSVLNKEKIKMDIESISGIGGDGSGGGGQNSESKQGVELSTTQRQEVQMKKSKLVGMLDEMECETDKNVFTHYQYLFPPENGSRVKE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_73354

• Blastp: BEL1-like homeodomain protein 1 from Arabidopsis with 32.92% of identity
• Blastx: BEL1-like homeodomain protein 1 from Arabidopsis with 30.77% of identity
• Eggnog: homeobox(ENOG410XPMQ)
• Kegg: Link to kegg annotations (AT2G35940)
• CantataDB: Link to cantataDB annotations (CNT0000379)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453837.1)
• Pfam: Associated with HOX (PF07526.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;