Protein coding transcript 208378

• Transcript: Ll_transcript_73339
• CDS coordinates: 1347-1691 (+)
• Peptide sequence: MQIVITSFEQVAGYGAAKSYTALALKTISKQFRCLKDAISSQIRATSKTLGEDDCLGVKVEGSRLRYVDHHLRQQKTLQQLGMIQHNVWRPQRGLPERAVSILRAWLFEHFLHP*
• ORF Type: complete

Annotations of Ll_transcript_73339

• Blastp: BEL1-like homeodomain protein 1 from Arabidopsis with 74.79% of identity
• Blastx: BEL1-like homeodomain protein 1 from Arabidopsis with 74.81% of identity
• Eggnog: homeobox(ENOG410XPMQ)
• Kegg: Link to kegg annotations (AT2G35940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453837.1)
• Pfam: Associated with HOX (PF07526.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;