Transcript | Ll_transcript_73339 |
---|---|
CDS coordinates | 1347-1691 (+) |
Peptide sequence | MQIVITSFEQVAGYGAAKSYTALALKTISKQFRCLKDAISSQIRATSKTLGEDDCLGVKVEGSRLRYVDHHLRQQKTLQQLGMIQHNVWRPQRGLPERAVSILRAWLFEHFLHP* |
ORF Type | complete |
Blastp | BEL1-like homeodomain protein 1 from Arabidopsis with 74.79% of identity |
---|---|
Blastx | BEL1-like homeodomain protein 1 from Arabidopsis with 74.81% of identity |
Eggnog | homeobox(ENOG410XPMQ) |
Kegg | Link to kegg annotations (AT2G35940) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453837.1) |
Pfam | Associated with HOX (PF07526.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer