Protein coding transcript 208397

• Transcript: Ll_transcript_71657
• CDS coordinates: 372-1106 (+)
• Peptide sequence: MEIEALEAILMDEFKEIHSGETGLSTSNRCFQITISQEEDSDGLITNPAQLALFFSHTEKYPDEPPLLNVKSLQGIPSEDLRIVKEKLQQEASENLGMAMIYTLVTSAKEWLDERFSEDNDENAEAEEAAKDDVVVPHGEPVTVDTFLAWRDRYEAELALERAKLMPEAVLSAPKEKKLTGRQWFESGRAKGAATVIEELDEEDDDDSDIDFDDEDFEDDEDDMLEHYLAEKSDSSTHSSRIAA*
• ORF Type: complete

Annotations of Ll_transcript_71657

• Blastp: RWD domain-containing protein 1 from Mus with 33.33% of identity
• Blastx: RWD domain-containing protein 1 from Mus with 35.68% of identity
• Eggnog: RWD domain containing(ENOG410XT0M)
• Kegg: Link to kegg annotations (66521)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455622.1)
• Pfam: RWD domain (PF05773.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;