| Transcript | Ll_transcript_71674 |
|---|---|
| CDS coordinates | 578-967 (+) |
| Peptide sequence | MAMIYTLVTSAKEWLDERFSEDNDENAEAEEAAKDDVVVPHGEPVTVDTFLAWRDRYEAELALERAKLMPEAVLSAPKEKKLTGRQWFESGRAKGAATVIEELDEEDDDDSDIDFDDEDFEDDEDDMLEH |
| ORF Type | 3prime_partial |
| Blastp | RWD domain-containing protein 1 from Rattus with 33.68% of identity |
|---|---|
| Blastx | RWD domain-containing protein 1 from Rattus with 34.23% of identity |
| Eggnog | RWD domain containing(ENOG410XT0M) |
| Kegg | Link to kegg annotations (259218) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019455622.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer