Protein coding transcript 208403

• Transcript: Ll_transcript_71677
• CDS coordinates: 628-1071 (+)
• Peptide sequence: MAMIYTLVTSAKEWLDDRFSEGNDGGAEAEEAAKDDIVVPHGEPVTVDTFLAWRERYEAELALERAKLMPEAVLSAPKEKKLTGRQWFESGRAKGASAVTDEPDEEDEEDSDIDFDDEDFEDDEDDMLEHYLAEKSDSSTHSSRIGS*
• ORF Type: complete

Annotations of Ll_transcript_71677

• Blastp: RWD domain-containing protein 1 from Rattus with 31.08% of identity
• Blastx: RWD domain-containing protein 1 from Homo with 32.47% of identity
• Eggnog: RWD domain containing(ENOG410XT0M)
• Kegg: Link to kegg annotations (259218)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424743.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;