| Transcript | Ll_transcript_71663 |
|---|---|
| CDS coordinates | 138-479 (+) |
| Peptide sequence | MDYTQDQEMEIEALEAILMDEFKEIHSGETGLSTSNRCFQITISQEEDSDGLITNPAQLALFFSHTEKYPDEPPLLNVKSLQGIPSEDLRIVKEKLQQEVVFYHAFFAVKCLS* |
| ORF Type | complete |
| Blastp | RWD domain-containing protein 1 from Mus with 37.5% of identity |
|---|---|
| Blastx | - |
| Eggnog | RWD domain containing(ENOG410XT0M) |
| Kegg | Link to kegg annotations (66521) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019455622.1) |
| Pfam | RWD domain (PF05773.21) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer