Protein coding transcript 208419

• Transcript: Ll_transcript_71474
• CDS coordinates: 170-1219 (+)
• Peptide sequence: MGFSQLFCILGWLTIAFSKVAWWLYIGRLLVGCGIGLLSYVVPIYVAEITPKNLRGTFTAVHQLMIGFGMSLTYLIGAYLDWRVVALIGTIPCLVQLLSLPFIPDSPRWLAKVGNMKESDSALQRLRGRNTDVNQEAAEIKEYTEALQRQKEASIIGLFQSQYLKALTVGVGLMILQQFGGINGIVFYVNSIFIAAGLSKSIGTIALVAVKIPMTTLGVLLMDRSGRRPLLLVSAGGTCLGCFLTAISFFLQDLHKWKEASPVLALVGVLVYVGSFSLGIGAIPWIIMSEIFPINVKGSAGSFVTLVNWLCSWIVSYAFNFLMSWSSSGTFTIFSTICGFTVLFVAKLVP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_71474

• Blastp: Sugar transporter ERD6-like 5 from Arabidopsis with 64.29% of identity
• Blastx: Sugar transporter ERD6-like 5 from Arabidopsis with 58.87% of identity
• Eggnog: Transporter(ENOG410XNQK)
• Kegg: Link to kegg annotations (AT1G54730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440523.1)
• Pfam: Major Facilitator Superfamily (PF07690.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;