Transcript | Ll_transcript_318474 |
---|---|
CDS coordinates | 2-382 (+) |
Peptide sequence | KGNGRKPLVEVNNHEEFLQPHTPAKKPRKSVYASCSGPRPATVTSEQCDSYLRQLHQQVAEFILSRPKKLAHIDLDDISDPAAQPFVWISKWVDYSDKYGFGYQLCDDGVGVMFNDASKLVLFPTQQ |
ORF Type | internal |
Blastp | Serine/threonine-protein kinase polo from Sophophora with 44% of identity |
---|---|
Blastx | Serine/threonine-protein kinase polo from Sophophora with 44% of identity |
Eggnog | Polo-like kinase(ENOG410XQBP) |
Kegg | Link to kegg annotations (Dmel_CG12306) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_016187801.1) |
Pfam | POLO box duplicated region (PF00659.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer