Protein coding transcript 2085

• Transcript: Ll_transcript_318474
• CDS coordinates: 2-382 (+)
• Peptide sequence: KGNGRKPLVEVNNHEEFLQPHTPAKKPRKSVYASCSGPRPATVTSEQCDSYLRQLHQQVAEFILSRPKKLAHIDLDDISDPAAQPFVWISKWVDYSDKYGFGYQLCDDGVGVMFNDASKLVLFPTQQ
• ORF Type: internal

Annotations of Ll_transcript_318474

• Blastp: Serine/threonine-protein kinase polo from Sophophora with 44% of identity
• Blastx: Serine/threonine-protein kinase polo from Sophophora with 44% of identity
• Eggnog: Polo-like kinase(ENOG410XQBP)
• Kegg: Link to kegg annotations (Dmel_CG12306)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016187801.1)
• Pfam: POLO box duplicated region (PF00659.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;