Protein coding transcript 208500

• Transcript: Ll_transcript_72873
• CDS coordinates: 139-786 (+)
• Peptide sequence: MAVTMKNNVNKNNVSSTCLFCVPTLFLLFTLLSIFSISHLSSNPSFSLPSSSSSSSSINVYVADLPRSLNYDLLHRYWSFNSDSRLGSDADLEIRSTHISKTLKFPPYPQNPLIKQYSAEYWIMGDLMTPPEMRNGSIAKRVFDARDADVVFVPFFATLSAEMQLAMAKSVFRKKVGNDDYLRQREVMDFVTNTEAWKRSGGRDHVFVLTGYLKN*
• ORF Type: complete

Annotations of Ll_transcript_72873

• Blastp: Probable arabinosyltransferase ARAD2 from Arabidopsis with 26.32% of identity
• Blastx: Probable arabinosyltransferase ARAD1 from Arabidopsis with 44.51% of identity
• Eggnog: Exostosin(ENOG410XTFH)
• Kegg: Link to kegg annotations (AT5G44930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427550.1)
• Pfam: Exostosin family (PF03016.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;