Transcript | Ll_transcript_72873 |
---|---|
CDS coordinates | 139-786 (+) |
Peptide sequence | MAVTMKNNVNKNNVSSTCLFCVPTLFLLFTLLSIFSISHLSSNPSFSLPSSSSSSSSINVYVADLPRSLNYDLLHRYWSFNSDSRLGSDADLEIRSTHISKTLKFPPYPQNPLIKQYSAEYWIMGDLMTPPEMRNGSIAKRVFDARDADVVFVPFFATLSAEMQLAMAKSVFRKKVGNDDYLRQREVMDFVTNTEAWKRSGGRDHVFVLTGYLKN* |
ORF Type | complete |
Blastp | Probable arabinosyltransferase ARAD2 from Arabidopsis with 26.32% of identity |
---|---|
Blastx | Probable arabinosyltransferase ARAD1 from Arabidopsis with 44.51% of identity |
Eggnog | Exostosin(ENOG410XTFH) |
Kegg | Link to kegg annotations (AT5G44930) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427550.1) |
Pfam | Exostosin family (PF03016.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer